parsed.org

Tips by tag: shell

Add a Newline to the End of a File by cygnus on Dec 31, 2005 04:09 PM

Use sed to add a newline to the end of a file (this will perform an in-place replacement and create a backup file, MYFILE.bak):

$ sed -i.bak '$G' MYFILE

Some programs, such as Emacs, will omit the trailing newline from a file unless configured to add one. Emacs can be configured to add a newline automatically.

backupcommandsconfigurationeditorsemacsin-placeline-endingsnewlinesedshell
Available DNS Entries in a Network by XeRoc on Dec 07, 2007 06:33 AM

Show all DNS in 192.168.0.*; only if reverse DNS is enabled on DNS server:

$ for I in `seq 1 254`; do host 192.168.0.$I | grep ^[^Host] | sed "s/.in-addr.*pointer/ points to ---->\t/"; done
dnsshell
Background Process by xinu on Dec 31, 2005 04:10 PM

If you need a process to survive your logging out of the system (or being knocked off of it), you can either screen it or wrap it with nohup. If you nohup, you'll lose control of it entirely, but the output will be written to nohup.out. With screen you can re-attach and take control later:

# nohup program -opts args &

-or-

# screen (press 'ctrl+a d' to detach after you've run the proc)
commandsloginlogoutnohupprocessscreenshell
Change Field Separator in Data by cygnus on Jan 12, 2005 10:27 AM

You can use awk to change the field separator in a data stream:

$ cat foo
a,b,c,d,e,f
a,b,c,d,e,f
$ awk 'BEGIN { FS = ","; OFS = ".."; } { $1 = $1; print }' foo
a..b..c..d..e..f
a..b..c..d..e..f

(You just have to touch one of the fields to get it to process the line.)

awkcommandsfieldsparsingshell
Changing Process Priority by xinu on Mar 10, 2005 01:52 PM

Ever been on a machine that was ailing and just wouldn't respond? As soon as you're root, lower the priority of the offending process ID(s) (in this example, 1103) by using the 'renice' command:

# renice -19 1103
commandsconfigurationcontroldebuggingmonitoringpriorityprocessrecoveryrenicerescuesecurityshell
Convert DOS Files by xinu on Jan 20, 2005 10:55 AM

There are a few different ways to convert a DOS file to Unix format, but the most available is probably this:

$ col -bx < dosfile > unixfile
colcommandsconvertdosfilterline-endingsnewlineshellunix
Convert Man to HTML by xinu on Jan 12, 2005 11:00 AM

Convert a man page to HTML for easy viewing online:

$ gunzip < /usr/local/man/man8/lsof.8.gz | nroff -man | man2html -title "lsof" > otmp/lsof.html
commandsconvertfiltergunziphtmlman2htmlmanpagenroffonlineshell
Copying a filesystem by xinu on Jan 12, 2005 10:59 AM

Here is a way to copy an entire filesystem without descending down its subsumed mount points. This example uses the root filesystem:

$ find / -xdev | cpio -pm /desired/location
commandscopycpiofilesystemfindrootshell
Debugging Bind 9.x by xinu on Jan 15, 2005 02:54 PM

If you need to see what queries are coming through your nameserver, toggle the querylog flag by typing:

$ rndc querylog
bindbind9commandsdnsnameserverquerylogrndcshell
Decrypt RSA Key by xinu on Sep 10, 2005 12:15 AM

Tired of typing your SSL password on boot of your webserver? You can decrypt it if you're certain it's safe:

# openssl rsa -in server.key -out server.key.unsecure
apachebootcommandsencryptionkeyopensslsecurityshellsslwebserver
Deleting Troublesome Files by xinu on Dec 19, 2007 01:38 PM

You've entered a command with an option that didn't exist and somehow you now have a file that starts with a hyphen (i.e., -myfile). If you try to remove it, rm thinks that you're offering up the options m, y, f, i, l, and e. No good, but you can give this a try instead:

$ rm -- -myfile

The double-hyphen will disable option parsing and let you delete the file with no problem.

dashesoptionsrmshell
Diff & Patch by xinu on Jan 12, 2005 12:30 PM

Make a recursive copy of your source tree before any changes (pristine version). E.g., copy project/ to project-pristine/.

After the changes, run this command:

$ diff -crN old new > output.diff
- or -
$ diff -crN project-pristine project > name_of_change.diff

On the target system in /path/to/project/../:

$ patch -p0 --dry-run < ./name_of_change.diff

Remove --dry-run to make it take effect.

commandsdiffpatchprogrammingshell

To create a .ico file that can be used for the favicon.ico on webpages, you can use a nice little program called png2ico. There is no package for this in Debian or Ubuntu so you will need to compile it yourself. Compilation is very straightforward. You do need a libpng package. Most of the time it will be installed but if you see an error, just searching for that file will yield the package you need to get for your distribution.

The session below uses /usr/local/src for the compilation and installed to /usr/local/bin. It can be compiled anywhere and installed anywhere, but having it in your $PATH makes things easier:

$ cd /usr/local/src
$ wget http://www.winterdrache.de/freeware/png2ico/data/png2ico-src-2002-12-08.tar.gz
$ tar xvzf png2ico-src-2002-12-08.tar.gz
$ cd png2ico
$ make
$ sudo cp png2ico /usr/local/bin/
$ sudo cp doc/png2ico.1 /usr/local/man/man1/

Once compiled, upload your png images. They should be square; sizes 16x16 and 32x32 are suggested. To create the icon you would then call the following:

$ png2ico favicon.ico your_favicon16x16.png your_favicon32x32.png

Afterwards you will then have a favicon.ico file. You then place this in the webroot of your website add the following to <head></head> section of your webpages:

<link rel="shortcut icon" href="/favicon.ico" />

It's good form to include it, but most common browsers automatically look for an icon at that location.

commandsconvertfaviconiconimagepng2icoshellweb
External SSH Access by xinu on Dec 13, 2005 10:23 AM

You need to get someone into an internal machine that doesn't have a public IP? Use an SSH tunnel. For this example, machine_a is your internal machine and machine_b is external:

$ ssh -R 9000:localhost:22 you@machine_b

Once you've logged in, you should be able to run this on machine_b:

$ ssh -p 9000 you@localhost
commandsnetworkshellsshtunnel
FIFOs Are Great by xinu on Jan 12, 2005 10:52 AM

If you want to tail the errors on another terminal, just push them to a fifo:

$ mkfifo pgerror
$ psql -U user dbname < ./dbfile 2> pgerror

On your other terminal:

$ tail -f pgerror

Voila! STDOUT on the main terminal, and STDERR on the secondary.

commandserrorsmkfifopipepsqlredirectshelltailterminal
Find and Zip by xinu on Jan 12, 2005 10:59 AM

To zip up the contents of a directory (selectively), use find and zip:

$ find . -type f -name "*.jpg" | zip -@ myimages.zip
commandsdirectoryfindshellzip
Find the Hog by xinu on Sep 10, 2005 12:00 AM

If you need to find the process hogging your CPU, try this:

$ ps aux | awk '!/root|nobody/ { if ($4>2) {print $2}}'
awkcpuownerpipeprocessrootshelluser
Globbing by xinu on Feb 08, 2005 12:27 PM

An often-used concept in shell scripting is globbing. You can use this in python, as well:

import glob

for textFile in glob.glob("*.txt"):
    # Do something with 'textFile'.
globimportlanguagesmodulesprogrammingpythonshell
Grep: Show only filenames by cygnus on Jun 03, 2005 11:12 AM

You can have grep show only the filenames that matched (instead of showing all lines in those files that matched) by using the -l switch:

$ grep -l SELECT *.sql
file1.sql
file2.sql

grep will only list unique filenames (i.e. a file with two matches will only be listed once).

commandsgrepshellunique
Halting a Script After Command Failure by cygnus on Dec 12, 2005 10:59 AM

A shell script which runs a sequence of commands will run them all even if some of them fail. This is rarely desirable, as later commands will usually depend on the success of prior ones.

You can use && between commands to implement this dependency, of course, or you can use the -e switch on the shebang line (works with bash, may work with other shells) to cause the interpreter to halt execution after any command returns a non-zero exit code:

#!/.../bash -e
bashhaltlogicoperatorsshell
Hidden Characters by xinu on Aug 27, 2007 08:18 PM

If you need to know where a line ends, where unprintable characters lurk, and the difference between white space and tabs, you can always remember to take the cat to the vet:

$ <commands> | cat -vet
catcharacterscommandscrlfshell
In-place Sed Replace by xinu on Jan 12, 2005 11:54 AM

This command will replace occurrences of foo with bar in the file X in-place and create a backup of X in X.old:

$ sed -i.old "s/foo/bar/g" filename
backupcommandsin-placesedshell
Ipchains Loop by xinu on Sep 28, 2005 10:57 AM

If you need to fool a machine into believing that a host:port pair is local, you can use ipchains to redirect traffic. For example, the desired destination is www.example.com:80 and you want it to go to localhost:8080:

# echo '1' > /proc/sys/net/ipv4/ip_forward
# ipchains -A input -j REDIRECT 8080 -p tcp -s 0.0.0.0/0 -d 0.0.0.0/0 80

Note: No one really uses ipchains anymore, but it can be found on older systems.

commandsfirewallip_forwardipchainsloopredirectshell
Keeping a Screen Open by cygnus on Jan 23, 2005 02:21 PM

You can use this in your shell dotfile (e.g. ~/.bash_profile, ~/.zshrc) to create a screen session when you log in or reattach to an existing screen:

if [[ $TERM != 'screen' ]] ; then
    if [[ `screen -list | grep -v "No" | awk '$2 { print }' | wc -l` == 0 ]] ; then
        screen
    else
        screen -dr
    fi
fi

This works in bash and zsh.

attachbash_profilebootconfigurationscreenscreenrcsessionshellstartup
Listing Open Files in Solaris 10 by xinu on Aug 15, 2007 11:43 AM

Since lsof is tragically broken in Solaris 10, you have to try other methods of finding out which ports a given PID has opened:

# pfiles 2602 &> output

That will redirect stdout and stderr to a file (output) that will outline any files (and ports; remember, everything is a file) that the process has open.

commandslsofpfilesshellsolaris
Log Chopping by xinu on Jan 12, 2005 11:01 AM

Given a log file with a date in the first column, chop up the file into separate file:

$ awk '/^[0-9]/ {print $0 > $1".log"}' logfile.txt

If you have a string that has characters that the shell won't like, you can do a substitution on them:

$ awk '{gsub("/","_",$1); print $1 > $1".log"}' logfile.txt
awkchoplogshellsplit
Lowercase Conversion by xinu on Jan 12, 2005 11:02 AM

If you find yourself needing to drop the case on the entire contents of a file, you can try this:

$ dd if=original of=filtered conv=lcase

-or-

$ tr '[A-Z]' '[a-z]' < original > filtered
charactersconversionddfilterlowercaseshelltr
Multiple Delimiters by xinu on Jan 12, 2005 12:32 PM

If you need to fetch a substring, but you have more than one delimiter, throw them all in there on the -F option to awk.

Given the text <VirtualHost 192.168.1.0:80>:

$ awk -F" |>" '/^<Virtual/ {print $2}'

Would return 192.168.1.0:80.

awkdelimitershell
MySQL Windows CLI by xinu on Jul 27, 2007 03:28 PM

To log into MySQL using the CLI in windows:

(in the mysql\bin directory)
c:\mysql\bin> mysql --user=<user> --pass=<pass> --port=3306
commandlinecommandsmicrosoftmysqlshellwindows
No Clobber File! by xinu on Feb 27, 2007 12:02 PM

Have you ever entered a command that involved redirection and just stared at it, palms sweating, heart racing, hoping against hope that, after all the variables interpolate, it doesn't destroy any of your crucial system files sitting nearby?

Enter: noclobber

If you're using the Bash shell, you can set this option to prevent overwriting of existing files. To see your current settings:

bash-2.05$ set -o
allexport       off
braceexpand     on
errexit         off
hashall         on
histexpand      on
keyword         off
monitor         on
noclobber       off
...

To set noclobber:

bash-2.05$ set -o noclobber
bashnoclobbershell
Open a Backgrounded SSH Tunnel by cygnus on May 06, 2006 12:10 AM

If you want to open an SSH tunnel in the background, use the -N and -f switches:

ssh -Nf -L2121:localhost:21 user@host
authenticationencryptionsecurityshellsshtunnel
Pipe Read by xinu on Jan 25, 2005 02:01 PM

If you want the time, and only the time:

$ date | (read u v w x y z; echo $x)
14:05:52
commandsdateextrasparsingshell
Quick history search by felipec on Jul 10, 2007 04:24 PM

Add the following to your ~/.inputrc:

"\e[5~": history-search-backward
"\e[6~": history-search-forward

And of course, in order to use your ~/.inputrc you need to set your INPUTRC environment variable in ~/.bash_profile:

export INPUTRC=$HOME/.inputrc

The next time you login you will be able to run "gvim <pageup>" and the last entry that started with "gvim " will appear, <pageup> again will bring the next one up, and so on.

Note that escape codes for PageUp and PageDown vary depending on your terminal type; check out this tip for a technique on how to find out what your terminal expects.

bashcommandshistoryinputrcshell
Ranged Curl by xinu on Jan 15, 2005 02:29 PM

If you have a URL that you need to crawl and you know the range of numbers in the image, you can do something like this:

$ curl -O http://www.example.com/img/samples[00-99].jpg

That should (at least attempt to) fetch the images samples00.jpg through samples99.jpg. Enjoy!

If you're using more than one range, you'll want to build your filename or a path with the --create-dirs option. For example:

$ curl http://www.example.com/imgs[00-99]/samples[00-27].jpg --create-dirs -o "#1/#2.jpg"

Alternatively, you can just be ghetto and name the files like dirname_filename.jpg:

$ curl http://www.example.com/images[00-99]/samples[00-27].jpg -o "#1_#2.jpg"
commandscurlextrasimageshellurl
Recursive WGET by xinu on Jan 12, 2005 10:57 AM

Download an entire directory tree:

$ wget -r ftp://username:password@site/path/to/suck
commandsdirectorydownloadftpshelltreewget
$ echo file.ext1.ext2 | cut -d"." -f1-2
cutextensionfileshshell
Remove a file's extension with sed by skypher on Jul 31, 2008 04:36 AM

$ echo file.ext1.ext2 | sed 's/.[^.]*$//' file.ext1

extensionfilesedshshell

You can use tr to remove non-printable characters from a data stream:

$ tr -cd '\11\12\40-\176' < $INPUT_FILE > $OUTPUT_FILE

(This tip taken from http://www.devdaily.com/unix/edu/un010011/.)

charactersconvertfilternon-printableshelltr
Resizing Images by xinu on Nov 03, 2005 08:00 AM

If you find yourself on a machine without the semi-ubiquitous ImageMagick packages, you might at least have pnmscale. Starting with a PNG file, you can do the following to resize it to 450 pixels wide:

$ pngtopnm < ./firefox-upgrade.png | pnmscale -x 450 | cjpeg -smoo 100 -qual 100 > firefox-upgrade.jpg
cjpegcommandsconvertfilterimageimagemagickpngpngtopnmpnmscaleresizescaleshell
Restricting SCP Bandwidth Usage by cygnus on Oct 17, 2005 04:28 PM

You can use the -l <kilobits_per_sec> option with scp (NOT ssh or sftp) to restrict the bandwidth used to transfer files:

$ scp -l 200 user@host:~/files .
bandwidthcommandsnetworkrate-limitingscpsftpshellssh
Ruby One Liners: Double space a file by Steven on Dec 19, 2007 11:01 AM

At the command line:

$ ruby -pe 'puts' < file.txt
double-spaceone-linersrubyshell

#prints line number 52 from file.txt $ ruby -pe 'next unless $. == 52' < file.txt

one-linersrubyshell
Save and View Pipe Stream by xinu on Mar 10, 2005 01:37 PM

You can use the tee program to save the contents of a pipe to a file while also viewing it on standard out:

# tail -0f /var/log/httpd/error_log | tee ~/newest_errors.txt

Note: tail -0 instructs tail to begin at the very end of the file (the default is to show the last ten lines), and -f means tail will periodically check the file for additional data and print the data to standard out.

commandsdebuggingmonitoringpipeshellstdouttailteeutilities
SCP Symlinks by xinu on Dec 19, 2005 12:05 PM

If you're running scp -r, beware of symlinks; they are followed rather than preserved. This might be favorable behavior if you're referencing files outside what you're copying, but if you're copying symlinks which reference other parts of what you're copying, the referenced files will be duplicated on the destination host.

Take, for example, the following files on host A:

~/myfiles/
  foo/
    a.txt
  bar/ -> foo/

When you run this command on host B:

joe@B:~$ scp -r joe@A:~/myfiles .

The result on host B will be:

~/myfiles/
  foo/
    a.txt
  bar/
    a.txt
commandsgotcharecursivescpshellsymlinks
Showing Duplicated Lines in a File by cygnus on Feb 15, 2005 04:09 PM

You can use this command to show duplicate lines in a file:

$ uniq -d MYFILE
commandsduplicatesfiltershellsortuniq
Simple swap monitor by mandric on Sep 25, 2007 06:32 PM

This is a simple swap monitor script:

#!/bin/bash
# Notify me one time if my swap is over MAXSWAP and log the
# swap usage as well in SWAPLOG.
# Usage: ./monitor.sh &

SWAPLOG=~/logs/monitor/swap
MAXSWAP=5
INTERVAL=30

send_sms_msg () {
  if [ "$1" ]; then STRING=$1; fi
  if [ $SMS_SENT ]; then
    return 0
  else
    echo $STRING | mailx -s 'monitor msg' 5101234567@cingularme.com
    SMS_SENT=1
  fi
}

while true; do
    # parse free output, get current swap value
    swaptest=`free -m |grep Swap|perl -pe 's/Swap:\s+\S+\s+(\S+).*/$1/'`
    if [ $swaptest -ge $MAXSWAP ]; then
        echo `date` Swap is: $swaptest >> $SWAPLOG
        send_sms_msg "Swap is: $swaptest"
    fi;
    sleep $INTERVAL
done;
bashmemorymonitorscriptshellswaptools
Standalone Procmail by xinu on Sep 10, 2005 12:10 AM

You have a mailbox you need to sort. You can't have it come back through your MTA, of course. Use this script to push it through the procmail filter of your choice:

#!/bin/sh

ORGMAIL=/var/spool/mail/$LOGNAME

if cd $HOME &&
  test -s $ORGMAIL &&
  lockfile -r0 -l3600 .newmail.lock 2>/dev/null
then
  trap "rm -f .newmail.lock" 1 2 3 15
  umask 077
  lockfile -l3600 -ml
  cat $ORGMAIL >>.newmail &&
  cat /dev/null >$ORGMAIL
  lockfile -mu
  formail -s procmail <.newmail &&
  rm -f .newmail
  rm -f .newmail.lock
fi
exit 0
commandsmailboxmtaprocmailscriptsshellsort
Syntax Highlighting by xinu on Dec 31, 2005 04:11 PM

If you would like to have syntax highlighting on a file that would otherwise not have any highlighting at all, you can symlink the file to the appropriate extension and open it:

$ ln -s example.lxp example.html
$ vi example.html # opened with pretty highlighting

*Note: This should be used sparingly and you should clean up your symlinks.

commandseditorshighlightingshellsymlinksyntaxvi
Tar + SSH by xinu on Feb 10, 2005 05:39 PM

To transfer files via tar/ssh, do the following:

$ tar cvjf - * | ssh user@remote "(cd /desired/path; tar xjf -)"
commandspipeshellsshtartunnel
Testing Webserver with Netcat & Echo by xinu on Jan 12, 2005 10:58 AM

Netcat is handy little utility for scripting all manners of network functionality. Here we're making sure a web server is responding as we'd expect:

$ (echo "GET / HTTP/1.1"; echo "Host: www.xinu.org"; echo) | nc www.xinu.org 80
commandsdebuggingmonitoringnetcatnetworkshellutilities
Tracking Down Symlinks by xinu on Jun 24, 2005 01:41 PM

Make sure you always specify a path free of symlinks. This can be pretty tough, though. An alternative approach is to use namei to track down symlinks:

# namei /usr/X11/bin/xterm
f: /usr/X11/bin/xterm
d /
d usr
l X11 -> X11R6
  d X11R6
d bin
- xterm
commandsdirectorynameipathshellsymlinkstree
Upload Directory Structure by xinu on Jul 12, 2006 01:48 PM

If you need to upload an entire directory structure, check out wput on sourceforge.net. It works the same way as wget only in the other direction (i.e., supporting various protocols).

http://wput.sourceforge.net/

Thanks to Aronalle for this tip!

commandsdownloadnetworkshellsourceforgeuploadwgetwput
Using 'strings' for Paths in a Binary by xinu on Sep 13, 2005 02:34 PM

If you need to discover on which paths a binary depends, you can sometimes run strings on it and grep for everything starting with a slash:

# strings /usr/sbin/named | grep ^/
/lib/ld-linux.so.2
/etc/named.conf
/etc/rndc.key
/etc/lwresd.conf
/etc/resolv.conf
/var/run/named/named.pid
/var/run/named/lwresd.pid
/dev/null
binaryconfigurationgrepprocessshellstrings
Variable Indirection by xinu on Jan 31, 2006 10:06 AM

Sometimes you need to iterate over variable names and access their values. In shell script, you would do something like this to get the values of FOO and BAR:

$ FOO=apple
$ BAR=orange
$ VARS="FOO BAR"
$ for v in $VARS ; do echo ${!v} ; done

The above works in bash. Use this in Zsh:

$ for v in $VARS ; do echo ${(P)v} ; done

(The 'P' flag on ${v} causes a further variable lookup before ${v} is evaluated.)

Thanks to Cliff for the tip!

bashcommandsenvironmentevaluationiterationloopshellzsh
Watching Connections by xinu on Jun 02, 2005 09:15 AM

If you want to use tcpdump to watch initiating connections (that is, the syn flag only is set indicating we're looking at the first third of the three-way handshake) on ports 80 and 443 you could do something like this:

# tcpdump '(tcp[13] & 0x3f = 2) and (dst port 80 or dst port 443)'
commandsconnectionsmonitoringnetworksecurityshelltcpdump
Xargs House-Cleaning by xinu on Jan 13, 2005 08:29 AM

If you have a bunch of files in your home directory and you want to push them into ~/sort, create the directory and then do the following:

$ find . -type f -maxdepth 1 ! -name ".?*" | xargs -I '{}' mv '{}' sort

Note: GNU xargs uses -i. BSD versions use -I.

bsdcommandsdirectoryfindgnushellsortxargs
Xargs & SSH by xinu on Apr 19, 2006 05:48 AM

Let's say you want to check the uptime on a list of servers. We're assuming that you've got a key on each machine otherwise you'll be entering your password often:

$ xargs -i ssh {} uptime < ./server.list
  5:46am  up 155 days, 17:49,  2 users,  load average: 0.12, 0.03, 0.01
  5:46am  up 147 days, 17:14,  2 users,  load average: 0.02, 0.05, 0.01
  5:46am  up 209 days, 17:26,  0 users,  load average: 0.00, 0.00, 0.00
  5:46am  up 89 days,  6:30,  0 users,  load average: 0.00, 0.00, 0.00
  5:46am  up 82 days,  6:40,  0 users,  load average: 0.07, 0.06, 0.01
  5:46am  up 104 days,  9:51,  0 users,  load average: 0.03, 0.03, 0.00
  5:50am  up 68 days,  9:17,  0 users,  load average: 0.00, 0.00, 0.00
  5:48am  up 68 days,  9:15,  0 users,  load average: 0.00, 0.00, 0.00
commandskeyloopremoteserversshellsshuptimexargs
RSS